Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,501 – 1,515 of 1,636,945 results

1,501

Invitrogen™ CD62L Monoclonal Antibody (Dreg-56), FITC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P14151
Isotype	IgG1 κ
Antigen	CD62L
Gene Symbols	SELL
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	A.11; AI528707; CD62 antigen-like family member L; CD62L; gp90-MEL; hLHRc; LAM1; LAM-1; LECAM1; LECAM-1; LEU8; Leu-8; Leukocyte adhesion molecule 1; leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LNHR; LSEL; L-selectin; Ly22; Ly-22; LYAM1; Lyam-1; Ly-m22; Lymph node homing receptor; lymphocyte adhesion molecule 1; lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; pln homing receptor; PLNHR; SELE; selectin E (endothelial adhesion molecule 1); selectin L; selectin L (lymphocyte adhesion molecule 1); selectin, lymphocyte; Sell; TQ1
Gene	SELL
Product Type	Antibody
Gene ID (Entrez)	6402
Formulation	PBS with BSA and 0.1% sodium azide
Immunogen	Human CD62L.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	Dreg-56

1,502

Invitrogen™ Ly-6C Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P0CW02
Isotype	IgG
Concentration	1 mg/mL
Antigen	Ly-6C
Gene Symbols	Ly6c1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA682074; AA959465; Ly6c; Ly-6C; Ly6c1; Ly-6C1; Ly6c2; lymphocyte antigen 6 complex, locus C; lymphocyte antigen 6 complex, locus C1; lymphocyte antigen 6C1; Lymphocyte antigen Ly-6C
Gene	Ly6c1
Product Type	Antibody
Gene ID (Entrez)	17067
Formulation	TBS with 0.2% BSA, 50% glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within mouse Ly6c1 aa 75-100.
Classification	Polyclonal
Primary or Secondary	Primary

1,503

Invitrogen™ CD45 Monoclonal Antibody (HI30), TRI-COLOR™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	TRI-COLOR
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P08575
Isotype	IgG1
Antigen	CD45
Gene Symbols	PTPRC
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	B220; cd45; CD45 antigen; CD45 antigen isoform 1 precursor; CD45 antigen isoform 2 precursor; CD45 antigen isoform 3 precursor; CD45 antigen isoform 4 precursor; CD45 antigen isoform 5 precursor; CD45 antigen isoform 6 precursor; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; leukocyte common antigen, CD45; loc; LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase C; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase lambda; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; protein tyrosine phosphatase; alternatively spliced; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen; T220 and B220
Gene	PTPRC
Product Type	Antibody
Gene ID (Entrez)	5788
Formulation	PBS with BSA, sucrose and 0.1% sodium azide
Immunogen	CD45 antigen.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HI30

1,504

Invitrogen™ Transthyretin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P02767, P07309
Isotype	IgG
Concentration	500 μg/mL
Antigen	Transthyretin
Gene Symbols	TTR
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA408768; AI787086; Amyloidosis I; ATTR; carpal tunnel syndrome 1; CTS; CTS1; D17860; epididymis luminal protein 111; HEL111; HsT2651; Lr1; PALB; prealbumin; pre-albumin; prealbumin, amyloidosis type I; Tbpa; thyroxine-binding prealbumin; transthyretin; Tt; TTR
Gene	TTR
Product Type	Antibody
Gene ID (Entrez)	22139, 24856
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived rat Prealbumin recombinant protein (Position: G21-N147).
Classification	Polyclonal
Primary or Secondary	Primary

1,505

Invitrogen™ CXCL14 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O95715, Q9WUQ5
Isotype	IgG
Concentration	1.73 mg/mL
Antigen	CXCL14
Gene Symbols	Cxcl14
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110031L23Rik; 1200006I23Rik; AI414372; B-cell and monocyte-activating chemokine; BMAC; bolekine; BRAK; breast and kidney; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; chemokine (C-X-C motif) ligand 14; chemokine BRAK; CXC; CXC chemokine in breast and kidney; CXC motif chemokine; C-X-C motif chemokine 14; C-X-C motif chemokine ligand 14; CXCL; Cxcl14; hypothetical protein LOC511771; Kec; Kidney-expressed chemokine CXC; KS1; MGC10687; MIP-2 gamma; MIP2G; MIP-2g; MIP2gamma; musculus CXC chemokine MIP-2gamma; NJAC; PSEC0212; SCYB14; small inducible cytokine B14; small inducible cytokine subfamily B (Cys-X-Cys), member 14; small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK); small-inducible cytokine B14; tumor-suppressing chemokine; UNQ240/PRO273
Gene	Cxcl14
Product Type	Antibody
Gene ID (Entrez)	57266, 9547
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the C-terminus region of human CXCL14. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,506

Invitrogen™ HSD17B13 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q5M875, Q7Z5P4, Q8VCR2
Isotype	IgG
Concentration	0.78 mg/mL
Antigen	HSD17B13
Gene Symbols	HSD17B13
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	17-beta hydroxysteroid dehydrogenase; 17-beta hydroxysteroid dehydrogenase 13; 17-beta-HSD 13; 17-beta-hydroxysteroid dehydrogenase 13; AI047820; Alcohol dehydrogenase PAN1B-like; HMFN0376; Hsd17b13; hydroxysteroid (17-beta) dehydrogenase 13; hydroxysteroid 17-beta dehydrogenase 13; NIIL497; Pan1b; PAN1B-like; SCDR9; SDR16C3; short chain dehydrogenase/reductase family 16C member 3; short chain dehydrogenase/reductase family 16C, member 3; short-chain dehydrogenase/reductase 9; UNQ497/PRO1014
Gene	HSD17B13
Product Type	Antibody
Gene ID (Entrez)	243168, 305150, 345275
Formulation	PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-211 of human HSD17B13 (NP_835236.2).
Classification	Polyclonal
Primary or Secondary	Primary

1,507

Invitrogen™ FOXG1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P55316, Q00939
Isotype	IgG
Concentration	0.87 mg/mL
Antigen	FOXG1
Gene Symbols	FOXG1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2900064B05Rik; Bf1; BF-1; BF1A; BF2; BF-2; brain factor 1; Brain factor 2; FHKL3; FKH2; FKHL1; FKHL2; FKHL3; FKHL4; forkhead box G1; forkhead box G1B; forkhead box protein G1; Forkhead box protein G1A; Forkhead box protein G1B; Forkhead box protein G1C; forkhead-like 1; forkhead-like 2; forkhead-like 3; forkhead-like 4; forkhead-like transcription factor BF-1; forkhead-related protein FKHL1; Forkhead-related protein FKHL2; Forkhead-related protein FKHL3; FOXG1; FOXG1A; FOXG1B; FOXG1C; HBF-1; HBF2; HBF-2; HBF-3; HBF-G2; Hfh9; Hfhbf1; HFK1; HFK2; HFK3; HNF-3/forkhead homolog, brain factor 1; KHL2; oncogene QIN; QIN; RATBF1A; transcription factor BF-1
Gene	FOXG1
Product Type	Antibody
Gene ID (Entrez)	2290, 24370
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of mouse FOXG1. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,508

Invitrogen™ MIF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P34884
Isotype	IgG
Concentration	1 mg/mL
Antigen	MIF
Gene Symbols	Mif
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography, Protein A
Gene Alias	cytokine; delayed early response protein 6; DER6; GIF; GLIF; glutathione-binding 13 kDa protein; Glycosylation-inhibiting factor; HGNC:7097; L-dopachrome isomerase; L-dopachrome tautomerase; macrophage migration inhibitory factor; macrophage migration inhibitory factor (glycosylation-inhibiting factor); MGC107654; Mif; MMIF; phenylpyruvate tautomerase
Gene	Mif
Product Type	Antibody
Gene ID (Entrez)	17319
Formulation	PBS with no preservative
Immunogen	Recombinant Mouse MIF protein (Pro2-Ala115).
Classification	Polyclonal
Primary or Secondary	Primary

1,509

Invitrogen™ CD14 Monoclonal Antibody (TuK4), FITC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P08571
Isotype	IgG2a
Antigen	CD14
Gene Symbols	Cd14
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	CD 14; CD14; CD14 antigen; CD14 molecule; cd14 monocyte; lipopolysaccharide receptor; lipoprotein receptor; LPSR antibody; monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14, membrane-bound form; Monocyte differentiation antigen CD14, urinary form; monocyte differentiation antigen CD14; LOW QUALITY PROTEIN: monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; myeloid membrane glycoprotein precursor; sCD14; soluble CD14
Gene	Cd14
Product Type	Antibody
Gene ID (Entrez)	929
Formulation	PBS with 4mg/mL BSA and 0.1% sodium azide
Immunogen	Human CD14.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TuK4

1,510

Invitrogen™ Glypican 3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13265, P51654, Q8CFZ4
Isotype	IgG
Concentration	1 mg/mL
Antigen	Glypican 3
Gene Symbols	GPC3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	defective in Simpson-Golabi-Behmel overgrowth syndrome; DGSX; glypican 3; glypican proteoglycan 3; glypican-3; Glypican-3 alpha subunit; Glypican-3 beta subunit; Gpc3; GTR22; GTR2-2; heparan sulphate proteoglycan; intestinal protein OCI-5; MXR7; OCI5; OCI-5; proteoglycan GPC3; SDYS; secreted glypican-3; SGB; SGBS; SGBS1
Gene	GPC3
Product Type	Antibody
Gene ID (Entrez)	14734, 25236, 2719
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human GPC3(Accession P51654), corresponding to amino acid residues R39-M89.
Classification	Polyclonal
Primary or Secondary	Primary

1,511

Invitrogen™ Phospho-CaMKII alpha/delta (Thr286) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P11275, P11798, P15791, Q13557, Q6PHZ2, Q9UQM7
Isotype	IgG
Concentration	1 mg/mL
Antigen	Phospho-CaMKII alpha/delta (Thr286)
Gene Symbols	CAMK2A, CAMK2D
Regulatory Status	RUO
Purification Method	sequential chromatography
Gene Alias	[d]-CaMKII; 2810011D23Rik; 8030469K03Rik; alpha CaM kinase II; alpha-CaMKII; Ca++/calmodulin-dependent protein kinase 2 delta subunit; Ca++/calmodulin-dependent protein kinase II delta subunit; Ca++/calmodulin-dependent protein kinase II, delta subunit; Ca2+/calmodulin-dependent protein kinase II alpha; calcium/calmodulin dependent protein kinase II alpha; calcium/calmodulin dependent protein kinase II delta; calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha; calcium/calmodulin-dependent protein kinase (CaM kinase) II delta; calcium/calmodulin-dependent protein kinase II alpha; calcium/calmodulin-dependent protein kinase II alpha subunit; calcium/calmodulin-dependent protein kinase II alpha-B subunit; calcium/calmodulin-dependent protein kinase II delta; calcium/calmodulin-dependent protein kinase II, delta; calcium/calmodulin-dependent protein kinase type II alpha chain; calcium/calmodulin-dependent protein kinase type II delta chain; calcium/calmodulin-dependent protein kinase type II subunit alpha; Calcium/calmodulin-dependent protein kinase type II subunit delta; CaM kinase II alpha subunit; CaM kinase II delta subunit; caM kinase II subunit alpha; CaM kinase II subunit delta; CaMK II; CAMK1; Camk2; CaMK2 delta; CaMK-2 delta; CaMK2- delta; Camk2a; CaMK-2a; CaMK2-a; CAMK2D; CAMKA; CAMKD; Camki; CaMKII; CaMK-II alpha subunit; CaMK-II delta subunit; caMK-II subunit alpha; caMK-II subunit delta; CaMKIINalpha; caM-kinase II alpha chain; CaM-kinase II delta chain; KIAA0968; Kiaa4163; mKIAA0968; PK2CDD; PKCCD; R74975; RATCAMKI
Gene	CAMK2D
Product Type	Antibody
Gene ID (Entrez)	108058, 12322, 24246, 25400, 815, 817
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human CAMK2A(Accession Q9UQM7), corresponding to amino acid residues around phosphorylated Thr286.
Classification	Polyclonal
Primary or Secondary	Primary

1,512

Invitrogen™ MGA Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Lyophilized
Gene Accession No.	Q8IWI9
Isotype	IgG
Concentration	500 μg/mL
Antigen	MGA
Gene Symbols	MGA
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AV312082; C130042M01Rik; C80739; D030062C11Rik; FLJ12634; KIAA0518; Kiaa4252; LOW QUALITY PROTEIN: MAX gene-associated protein; Mad5; maltase-glucoamylase (alpha-glucosidase); Max dimerization protein 5; MAX dimerization protein MGA; MAX gene associated; MAX gene-associated protein; MAX protein-associated protein-like protein; MAX-associated protein; MAX-interacting protein; MGA; MGA, MAX dimerization protein; MGA-like protein; MXD5; RGD1561597
Gene	MGA
Product Type	Antibody
Gene ID (Entrez)	23269
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH).
Classification	Polyclonal
Primary or Secondary	Primary

1,513

Invitrogen™ CD45RO Monoclonal Antibody (UCHL1), PE

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P08575
Isotype	IgG2a
Antigen	CD45RO
Gene Symbols	PTPRC
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	B220; Cd45; CD45 antigen; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; loc; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; PTPRC; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen
Gene	PTPRC
Product Type	Antibody
Gene ID (Entrez)	5788
Formulation	PBS with sucrose, 4mg/mL BSA and 0.1% sodium azide
Immunogen	Human CD45RO.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	UCHL1

1,514

Invitrogen™ E. coli PDF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Bacteria
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	E. coli PDF
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	2610019N19Rik; PDF; PDF1A; peptide deformylase (mitochondrial); peptide deformylase, mitochondrial; peptide deformylase-like protein; peptide deformylase-like protein-like; polypeptide deformylase; similar to peptide deformylase-like protein
Product Type	Antibody
Formulation	PBS with 50% glycerol and 0.03% ProClin 300; pH 7.4
Immunogen	Recombinant Escherichia coli Peptide deformylase protein (2-169aa).
Classification	Polyclonal
Primary or Secondary	Primary

1,515

Invitrogen™ IFI30 (Precursor) Recombinant Rabbit Monoclonal Antibody (3H6L14)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13284
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	IFI30 (Precursor)
Gene Symbols	IFI30
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Gamma-interferon-inducible lysosomal thiol reductase; gamma-interferon-inducible protein IP-30; GILT; IFI30; IFI-30; IFI30, lysosomal thiol reductase; interferon gamma inducible protein 30; interferon gamma-inducible protein 30 preproprotein; interferon, gamma-inducible protein 30; IP30; IP-30; Legumaturain
Gene	IFI30
Product Type	Antibody
Gene ID (Entrez)	10437
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to human IF130 [1) aa38-aa56 2)aa233-aa250].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	3H6L14

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD62L Monoclonal Antibody (Dreg-56), FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ly-6C Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD45 Monoclonal Antibody (HI30), TRI-COLOR™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Transthyretin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CXCL14 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HSD17B13 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FOXG1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MIF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD14 Monoclonal Antibody (TuK4), FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Glypican 3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-CaMKII alpha/delta (Thr286) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MGA Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD45RO Monoclonal Antibody (UCHL1), PE Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ E. coli PDF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD62L Monoclonal Antibody (Dreg-56), FITC

Invitrogen™ Ly-6C Polyclonal Antibody

Invitrogen™ CD45 Monoclonal Antibody (HI30), TRI-COLOR™

Invitrogen™ Transthyretin Polyclonal Antibody

Invitrogen™ CXCL14 Polyclonal Antibody

Invitrogen™ HSD17B13 Polyclonal Antibody

Invitrogen™ FOXG1 Polyclonal Antibody

Invitrogen™ MIF Polyclonal Antibody

Invitrogen™ CD14 Monoclonal Antibody (TuK4), FITC

Invitrogen™ Glypican 3 Polyclonal Antibody

Invitrogen™ Phospho-CaMKII alpha/delta (Thr286) Polyclonal Antibody

Invitrogen™ MGA Polyclonal Antibody

Invitrogen™ CD45RO Monoclonal Antibody (UCHL1), PE

Invitrogen™ E. coli PDF Polyclonal Antibody